SCOPe 2.08: Domain d2i32b_: 2i32 B:

Lineage for d2i32b_ (2i32 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (2 families)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
   Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156

8. Domain d2i32b_: 2i32 B: [147496]
   automated match to d2i32a1

Details for d2i32b_

PDB Entry: 2i32, 2.7 Å

PDB Description: structure of a human asf1a-hira complex and insights into specificity of histone chaperone complex assembly

PDB Compounds: (B:) Anti-Silencing Factor 1 paralog a

SCOPe Domain Sequences for d2i32b_:

Sequence; same for both SEQRES and ATOM records:

>d2i32b_ b.1.22.1 (B:) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwe

Timeline for d2i32b_:

• d2i32b_ first appeared in SCOP 1.75, called d2i32b1
  
• d2i32b_ appears in SCOPe 2.07