![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.22: ASF1-like [101546] (2 families) ![]() contains extra C-terminal strand automatically mapped to Pfam PF04729 |
![]() | Family b.1.22.1: ASF1-like [101547] (2 proteins) |
![]() | Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries) Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156 |
![]() | Domain d2i32b_: 2i32 B: [147496] automated match to d2i32a1 |
PDB Entry: 2i32 (more details), 2.7 Å
SCOPe Domain Sequences for d2i32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i32b_ b.1.22.1 (B:) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]} makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet elrenppvkpdfsklqrnilasnprvtrfhinwe
Timeline for d2i32b_: