Lineage for d2i00d2 (2i00 D:11-300)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037692Family d.108.1.10: EF1021-like [160644] (3 proteins)
    duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site
  6. 1037704Protein Putative acetyltransferase EF2353 [160645] (1 species)
  7. 1037705Species Enterococcus faecalis [TaxId:1351] [160646] (1 PDB entry)
    Uniprot Q831Y9 10-300
  8. 1037709Domain d2i00d2: 2i00 D:11-300 [147473]
    Other proteins in same PDB: d2i00a1, d2i00b1, d2i00c1, d2i00d1, d2i00e1, d2i00f1
    automatically matched to 2I00 A:10-300

Details for d2i00d2

PDB Entry: 2i00 (more details), 2.3 Å

PDB Description: Crystal structure of acetyltransferase (GNAT family) from Enterococcus faecalis
PDB Compounds: (D:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2i00d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i00d2 d.108.1.10 (D:11-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}
tlkpveeehidqfnellsyvfqvteadieesgfenkrafikskqpilelskvfgwfhenq
lisqiaiypcevnihgalykmggvtgvgtypeyanhglmkdliqtaleemrqdkqwisyl
fpynipyyrrkgweimsdklsfkirdtqlpktvpvpgmierlavdhpdvfdvyarfarqn
hgalirsafnweeywrfeneeertaavyyganqeplgvlfywvadevfhikemfylnqea
rnglwnfitahfsmvywvkgdiykneplaflledsqikesiepyymariv

SCOPe Domain Coordinates for d2i00d2:

Click to download the PDB-style file with coordinates for d2i00d2.
(The format of our PDB-style files is described here.)

Timeline for d2i00d2: