| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) ![]() |
| Family d.106.1.4: EF1021 C-terminal domain-like [160620] (3 proteins) |
| Protein Putative acetyltransferase EF2353 [160623] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [160624] (1 PDB entry) Uniprot Q831Y9 301-406 |
| Domain d2i00d1: 2i00 D:301-406 [147472] Other proteins in same PDB: d2i00a2, d2i00b2, d2i00c2, d2i00d2, d2i00e2, d2i00f2 automatically matched to 2I00 A:301-406 |
PDB Entry: 2i00 (more details), 2.3 Å
SCOPe Domain Sequences for d2i00d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i00d1 d.106.1.4 (D:301-406) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}
dvkaflenfpfestakpfhfvvkdpvaewnngifgliwdendqvtitdeplgtavhldiq
tltclvmnyrrpsylhrieridtdketlnslerifpdqeayfsdyf
Timeline for d2i00d1: