SCOPe 2.02: Domain d2hz5b_: 2hz5 B:

Lineage for d2hz5b_ (2hz5 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein automated matches [190414] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187290] (1 PDB entry)

8. Domain d2hz5b_: 2hz5 B: [147461]
   automated match to d1tgqa_
   complexed with cs

Details for d2hz5b_

PDB Entry: 2hz5, 2.1 Å

PDB Description: Crystal structure of human dynein light chain Dnlc2A

PDB Compounds: (B:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d2hz5b_:

Sequence, based on SEQRES records:

>d2hz5b_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqndlt
flrirskkneimvapdkdyfliviqnpt

Sequence, based on observed residues (ATOM records):

>d2hz5b_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqndlt
flrirskkneimvapdyfliviqnpt

Timeline for d2hz5b_:

• d2hz5b_ first appeared in SCOP 1.75, called d2hz5b1
  
• d2hz5b_ appears in SCOPe 2.01
  
• d2hz5b_ appears in SCOPe 2.03
  
• d2hz5b_ appears in the current release, SCOPe 2.08