Lineage for d2hz5b1 (2hz5 B:8-95)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870994Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 870995Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins)
    Pfam PF03259
  6. 870996Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)
  7. 870997Species Human (Homo sapiens) [TaxId:9606] [118075] (4 PDB entries)
    Uniprot Q9NP97
  8. 870999Domain d2hz5b1: 2hz5 B:8-95 [147461]
    automatically matched to 2B95 A:11-106
    complexed with cs

Details for d2hz5b1

PDB Entry: 2hz5 (more details), 2.1 Å

PDB Description: Crystal structure of human dynein light chain Dnlc2A
PDB Compounds: (B:) Dynein light chain 2A, cytoplasmic

SCOP Domain Sequences for d2hz5b1:

Sequence, based on SEQRES records: (download)

>d2hz5b1 d.110.7.1 (B:8-95) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
lkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqndlt
flrirskkneimvapdkdyfliviqnpt

Sequence, based on observed residues (ATOM records): (download)

>d2hz5b1 d.110.7.1 (B:8-95) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
lkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqndlt
flrirskkneimvapdyfliviqnpt

SCOP Domain Coordinates for d2hz5b1:

Click to download the PDB-style file with coordinates for d2hz5b1.
(The format of our PDB-style files is described here.)

Timeline for d2hz5b1: