SCOPe 2.01: Domain d2hyja2: 2hyj A:83-200

Lineage for d2hyja2 (2hyj A:83-200)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Putative transcriptional regulator SCO4940 [158798] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [158799] (1 PDB entry)
   Uniprot Q8CJS4 83-200

8. Domain d2hyja2: 2hyj A:83-200 [147457]
   Other proteins in same PDB: d2hyja1
   complexed with ca, so4

Details for d2hyja2

PDB Entry: 2hyj, 2.19 Å

PDB Description: The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor

PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2hyja2:

Sequence; same for both SEQRES and ATOM records:

>d2hyja2 a.121.1.1 (A:83-200) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}
ppglrrlravcansvgyleepllpggclltaalseydgrpgrvrdavaevwsrwreqlra
dltaavdkgelpagfdveqalfeivaaglalnaamqlqhdrtaadrarraieralaqs

Timeline for d2hyja2:

• d2hyja2 first appeared in SCOP 1.75
  
• d2hyja2 appears in SCOPe 2.02
  
• d2hyja2 appears in the current release, SCOPe 2.08