Lineage for d2hyja2 (2hyj A:83-200)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728104Protein Putative transcriptional regulator SCO4940 [158798] (1 species)
  7. 2728105Species Streptomyces coelicolor [TaxId:1902] [158799] (1 PDB entry)
    Uniprot Q8CJS4 83-200
  8. 2728106Domain d2hyja2: 2hyj A:83-200 [147457]
    Other proteins in same PDB: d2hyja1
    complexed with ca, so4

Details for d2hyja2

PDB Entry: 2hyj (more details), 2.19 Å

PDB Description: The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor
PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2hyja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyja2 a.121.1.1 (A:83-200) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}
ppglrrlravcansvgyleepllpggclltaalseydgrpgrvrdavaevwsrwreqlra
dltaavdkgelpagfdveqalfeivaaglalnaamqlqhdrtaadrarraieralaqs

SCOPe Domain Coordinates for d2hyja2:

Click to download the PDB-style file with coordinates for d2hyja2.
(The format of our PDB-style files is described here.)

Timeline for d2hyja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hyja1