| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Putative transcriptional regulator SCO4940 [158798] (1 species) |
| Species Streptomyces coelicolor [TaxId:1902] [158799] (1 PDB entry) Uniprot Q8CJS4 83-200 |
| Domain d2hyja2: 2hyj A:83-200 [147457] Other proteins in same PDB: d2hyja1 complexed with ca, so4 |
PDB Entry: 2hyj (more details), 2.19 Å
SCOPe Domain Sequences for d2hyja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyja2 a.121.1.1 (A:83-200) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}
ppglrrlravcansvgyleepllpggclltaalseydgrpgrvrdavaevwsrwreqlra
dltaavdkgelpagfdveqalfeivaaglalnaamqlqhdrtaadrarraieralaqs
Timeline for d2hyja2: