SCOPe 2.02: Domain d2hv2f1: 2hv2 F:287-397

Lineage for d2hv2f1 (2hv2 F:287-397)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.4: EF1021 C-terminal domain-like [160620] (3 proteins)

6. Protein Hypothetical protein EF1021 [160621] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [160622] (1 PDB entry)
   Uniprot Q836T6 287-397

8. Domain d2hv2f1: 2hv2 F:287-397 [147416]
   Other proteins in same PDB: d2hv2a2, d2hv2b2, d2hv2c2, d2hv2d2, d2hv2e2, d2hv2f2
   automatically matched to 2HV2 A:287-397
   complexed with epe, pg4

Details for d2hv2f1

PDB Entry: 2hv2, 2.4 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function from Enterococcus faecalis V583 at 2.4 A Resolution, Probable N-Acyltransferase

PDB Compounds: (F:) hypothetical protein

SCOPe Domain Sequences for d2hv2f1:

Sequence, based on SEQRES records:

>d2hv2f1 d.106.1.4 (F:287-397) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
elqtflekypfqsgeketysleiedsygpwnegiwtitideqgkatvtkgaaekegtaal
kadiqtwtqlflgyrsaetlsfyerlqgdatiaqrlgqrlvkgmpiledyf

Sequence, based on observed residues (ATOM records):

>d2hv2f1 d.106.1.4 (F:287-397) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
elqtflekypfqsgeketysleiedsygpwnegiwtitideqgkatvtkgataalkadiq
twtqlflgyrsaetlsfyerlqgdatiaqrlgqrlvkgmpiledyf

Timeline for d2hv2f1:

• d2hv2f1 first appeared in SCOP 1.75
  
• d2hv2f1 appears in SCOPe 2.01
  
• d2hv2f1 appears in SCOPe 2.03
  
• d2hv2f1 appears in the current release, SCOPe 2.08