Lineage for d2hv2f1 (2hv2 F:287-397)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869930Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 869931Superfamily d.106.1: SCP-like [55718] (4 families) (S)
  5. 869959Family d.106.1.4: EF1021 C-terminal domain-like [160620] (3 proteins)
  6. 869960Protein Hypothetical protein EF1021 [160621] (1 species)
  7. 869961Species Enterococcus faecalis [TaxId:1351] [160622] (1 PDB entry)
    Uniprot Q836T6 287-397
  8. 869967Domain d2hv2f1: 2hv2 F:287-397 [147416]
    Other proteins in same PDB: d2hv2a2, d2hv2b2, d2hv2c2, d2hv2d2, d2hv2e2, d2hv2f2
    automatically matched to 2HV2 A:287-397
    complexed with epe, pg4

Details for d2hv2f1

PDB Entry: 2hv2 (more details), 2.4 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function from Enterococcus faecalis V583 at 2.4 A Resolution, Probable N-Acyltransferase
PDB Compounds: (F:) hypothetical protein

SCOP Domain Sequences for d2hv2f1:

Sequence, based on SEQRES records: (download)

>d2hv2f1 d.106.1.4 (F:287-397) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
elqtflekypfqsgeketysleiedsygpwnegiwtitideqgkatvtkgaaekegtaal
kadiqtwtqlflgyrsaetlsfyerlqgdatiaqrlgqrlvkgmpiledyf

Sequence, based on observed residues (ATOM records): (download)

>d2hv2f1 d.106.1.4 (F:287-397) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
elqtflekypfqsgeketysleiedsygpwnegiwtitideqgkatvtkgataalkadiq
twtqlflgyrsaetlsfyerlqgdatiaqrlgqrlvkgmpiledyf

SCOP Domain Coordinates for d2hv2f1:

Click to download the PDB-style file with coordinates for d2hv2f1.
(The format of our PDB-style files is described here.)

Timeline for d2hv2f1: