SCOP 1.75: Domain d2hv2d2: 2hv2 D:2-286

Lineage for d2hv2d2 (2hv2 D:2-286)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families)

5. Family d.108.1.10: EF1021-like [160644] (3 proteins)
   duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site

6. Protein Hypothetical protein EF1021 [160649] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [160650] (1 PDB entry)
   Uniprot Q836T6 2-286

8. Domain d2hv2d2: 2hv2 D:2-286 [147413]
   Other proteins in same PDB: d2hv2a1, d2hv2b1, d2hv2c1, d2hv2d1, d2hv2e1, d2hv2f1
   automatically matched to 2HV2 A:2-286
   complexed with epe, pg4

Details for d2hv2d2

PDB Entry: 2hv2, 2.4 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function from Enterococcus faecalis V583 at 2.4 A Resolution, Probable N-Acyltransferase

PDB Compounds: (D:) hypothetical protein

SCOP Domain Sequences for d2hv2d2:

Sequence; same for both SEQRES and ATOM records:

>d2hv2d2 d.108.1.10 (D:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
ttkrvkkmgkeemkemfdlviyafnqeptaerqerfekllshtqsygflideqltsqvma
tpfqvnfhgvrypmagigyvasypeyrgeggisaimkemladlakqkvalsylapfsypf
yrqygyeqtfeqaeytiktedwprvkrvpgtikrvswadgkevikdvylenqrahsggvi
retwwldytlnraskpnnqaiyyssegkaegyviyriaagtfeivewnyltntafkalag
figshsgsvqsfhwingfagkdlndlmptpaasvkilpymmariv

Timeline for d2hv2d2:

• d2hv2d2 is new in SCOP 1.75
  
• d2hv2d2 appears in SCOPe 2.01
  
• d2hv2d2 appears in the current release, SCOPe 2.08