Lineage for d2hv2a2 (2hv2 A:2-286)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968941Family d.108.1.10: EF1021-like [160644] (3 proteins)
    duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site
  6. 2968942Protein Hypothetical protein EF1021 [160649] (1 species)
  7. 2968943Species Enterococcus faecalis [TaxId:1351] [160650] (1 PDB entry)
    Uniprot Q836T6 2-286
  8. 2968944Domain d2hv2a2: 2hv2 A:2-286 [147407]
    Other proteins in same PDB: d2hv2a1, d2hv2b1, d2hv2c1, d2hv2d1, d2hv2e1, d2hv2f1
    complexed with epe, pg4

Details for d2hv2a2

PDB Entry: 2hv2 (more details), 2.4 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function from Enterococcus faecalis V583 at 2.4 A Resolution, Probable N-Acyltransferase
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hv2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
ttkrvkkmgkeemkemfdlviyafnqeptaerqerfekllshtqsygflideqltsqvma
tpfqvnfhgvrypmagigyvasypeyrgeggisaimkemladlakqkvalsylapfsypf
yrqygyeqtfeqaeytiktedwprvkrvpgtikrvswadgkevikdvylenqrahsggvi
retwwldytlnraskpnnqaiyyssegkaegyviyriaagtfeivewnyltntafkalag
figshsgsvqsfhwingfagkdlndlmptpaasvkilpymmariv

SCOPe Domain Coordinates for d2hv2a2:

Click to download the PDB-style file with coordinates for d2hv2a2.
(The format of our PDB-style files is described here.)

Timeline for d2hv2a2: