| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.10: EF1021-like [160644] (3 proteins) duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site |
| Protein Hypothetical protein EF1021 [160649] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [160650] (1 PDB entry) Uniprot Q836T6 2-286 |
| Domain d2hv2f2: 2hv2 F:1-286 [147417] Other proteins in same PDB: d2hv2a1, d2hv2b1, d2hv2c1, d2hv2d1, d2hv2e1, d2hv2f1 automated match to d2hv2a2 complexed with epe, pg4 |
PDB Entry: 2hv2 (more details), 2.4 Å
SCOPe Domain Sequences for d2hv2f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hv2f2 d.108.1.10 (F:1-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
mttkrvkkmgkeemkemfdlviyafnqeptaerqerfekllshtqsygflideqltsqvm
atpfqvnfhgvrypmagigyvasypeyrgeggisaimkemladlakqkvalsylapfsyp
fyrqygyeqtfeqaeytiktedwprvkrvpgtikrvswadgkevikdvylenqrahsggv
iretwwldytlnraskpnnqaiyyssegkaegyviyriaagtfeivewnyltntafkala
gfigshsgsvqsfhwingfagkdlndlmptpaasvkilpymmariv
Timeline for d2hv2f2: