SCOPe 2.02: Domain d2hquc1: 2hqu C:24-158

Lineage for d2hquc1 (2hqu C:24-158)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)

8. Domain d2hquc1: 2hqu C:24-158 [147363]
   automatically matched to d1q5hc_
   complexed with cl, dup, mg

Details for d2hquc1

PDB Entry: 2hqu, 2.2 Å

PDB Description: human dutpase in complex with alpha,beta-iminodutp and magnesium ion

PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2hquc1:

Sequence, based on SEQRES records:

>d2hquc1 b.85.4.1 (C:24-158) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggf

Sequence, based on observed residues (ATOM records):

>d2hquc1 b.85.4.1 (C:24-158) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqf

Timeline for d2hquc1:

• d2hquc1 first appeared in SCOP 1.75
  
• d2hquc1 appears in SCOPe 2.01
  
• d2hquc1 is called d2hquc_ in SCOPe 2.03
  
• d2hquc1 appears in the current release, SCOPe 2.08, called d2hquc_