![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
![]() | Protein automated matches [191182] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226031] (5 PDB entries) |
![]() | Domain d2hqua_: 2hqu A: [147361] automated match to d4apza_ complexed with cl, dup, mg |
PDB Entry: 2hqu (more details), 2.2 Å
SCOPe Domain Sequences for d2hqua_:
Sequence, based on SEQRES records: (download)
>d2hqua_ b.85.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie evqalddtergsggfgstgkn
>d2hqua_ b.85.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqlrfarlsehataptrraagydlysaydytippmekavvktdiqialpsgcygrvaprs glaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeieevq alddtergsggfgstgkn
Timeline for d2hqua_: