Lineage for d2hq5d2 (2hq5 D:73-187)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502122Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1502123Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1502124Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1502167Protein Multidrug binding protein QacR [69107] (1 species)
  7. 1502168Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 1502185Domain d2hq5d2: 2hq5 D:73-187 [147334]
    Other proteins in same PDB: d2hq5a1, d2hq5b1, d2hq5d1, d2hq5e1
    automated match to d1rkwa2
    complexed with so4

Details for d2hq5d2

PDB Entry: 2hq5 (more details), 2.8 Å

PDB Description: crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359
PDB Compounds: (D:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2hq5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hq5d2 a.121.1.1 (D:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d2hq5d2:

Click to download the PDB-style file with coordinates for d2hq5d2.
(The format of our PDB-style files is described here.)

Timeline for d2hq5d2: