SCOPe 2.04: Domain d2hq5a2: 2hq5 A:73-187

Lineage for d2hq5a2 (2hq5 A:73-187)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
   Uniprot P23217

8. Domain d2hq5a2: 2hq5 A:73-187 [147330]
   Other proteins in same PDB: d2hq5a1, d2hq5b1, d2hq5d1, d2hq5e1
   automated match to d1rkwa2
   complexed with so4

Details for d2hq5a2

PDB Entry: 2hq5, 2.8 Å

PDB Description: crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359

PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2hq5a2:

Sequence; same for both SEQRES and ATOM records:

>d2hq5a2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d2hq5a2:

• d2hq5a2 first appeared in SCOP 1.75
  
• d2hq5a2 appears in SCOPe 2.03
  
• d2hq5a2 appears in SCOPe 2.05
  
• d2hq5a2 appears in the current release, SCOPe 2.08