Class a: All alpha proteins [46456] (285 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Multidrug binding protein QacR [69107] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries) Uniprot P23217 |
Domain d2hq5a2: 2hq5 A:73-187 [147330] Other proteins in same PDB: d2hq5a1, d2hq5b1, d2hq5d1, d2hq5e1 automated match to d1rkwa2 complexed with so4 |
PDB Entry: 2hq5 (more details), 2.8 Å
SCOPe Domain Sequences for d2hq5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hq5a2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls
Timeline for d2hq5a2: