SCOPe 2.02: Domain d2hq5a1: 2hq5 A:2-72

Lineage for d2hq5a1 (2hq5 A:2-72)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (20 PDB entries)
   Uniprot P23217

8. Domain d2hq5a1: 2hq5 A:2-72 [147329]
   Other proteins in same PDB: d2hq5a2, d2hq5b2, d2hq5d2, d2hq5e2
   automatically matched to d1jt0a1
   complexed with so4

Details for d2hq5a1

PDB Entry: 2hq5, 2.8 Å

PDB Description: crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359

PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2hq5a1:

Sequence; same for both SEQRES and ATOM records:

>d2hq5a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

Timeline for d2hq5a1:

• d2hq5a1 first appeared in SCOP 1.75
  
• d2hq5a1 appears in SCOPe 2.01
  
• d2hq5a1 appears in SCOPe 2.03
  
• d2hq5a1 appears in the current release, SCOPe 2.08