Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (20 PDB entries) Uniprot P23217 |
Domain d2hq5a1: 2hq5 A:2-72 [147329] Other proteins in same PDB: d2hq5a2, d2hq5b2, d2hq5d2, d2hq5e2 automatically matched to d1jt0a1 complexed with so4 |
PDB Entry: 2hq5 (more details), 2.8 Å
SCOPe Domain Sequences for d2hq5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hq5a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw qeqwkkeqika
Timeline for d2hq5a1: