SCOPe 2.08: Domain d2hq4a1: 2hq4 A:1-152

Lineage for d2hq4a1 (2hq4 A:1-152)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.342: PH1570-like [159901] (1 superfamily)
   duplication: two beta(4)-alpha structural repeats, related by pseudo twofold symmetry; two extra helices in the linker region; single 8-standed antiparallel beta-sheet, order: 12348765

4. Superfamily d.342.1: PH1570-like [159902] (1 family)
   automatically mapped to Pfam PF09638

5. Family d.342.1.1: PH1570-like [159903] (2 proteins)
   Pfam PF09638

6. Protein Hypothetical protein PH1570 [159904] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [159905] (1 PDB entry)
   Uniprot O59278 1-152

8. Domain d2hq4a1: 2hq4 A:1-152 [147327]
   Other proteins in same PDB: d2hq4a2, d2hq4b2, d2hq4b3

Details for d2hq4a1

PDB Entry: 2hq4, 1.99 Å

PDB Description: crystal structure of orf 1580 a hypothetical protein from pyrococcus horikoshii

PDB Compounds: (A:) Hypothetical protein PH1570

SCOPe Domain Sequences for d2hq4a1:

Sequence, based on SEQRES records:

>d2hq4a1 d.342.1.1 (A:1-152) Hypothetical protein PH1570 {Pyrococcus horikoshii [TaxId: 53953]}
mqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyvypfecakef
wniylegeeiqdeefqlkpikftseqvikklqeeikkikppleikieeakiyktkegyla
vgnyfildprgrlfifnkpsiankilkyiwkw

Sequence, based on observed residues (ATOM records):

>d2hq4a1 d.342.1.1 (A:1-152) Hypothetical protein PH1570 {Pyrococcus horikoshii [TaxId: 53953]}
mqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyvypfecakef
wniylegeeiqdqlkpikftseqvikklqeeikkikppleikieeakiyktkegylavgn
yfildprgrlfifnkpsiankilkyiwkw

Timeline for d2hq4a1:

• d2hq4a1 first appeared in SCOP 1.75
  
• d2hq4a1 appears in SCOPe 2.07