Lineage for d2hq4a1 (2hq4 A:1-152)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882748Fold d.342: PH1570-like [159901] (1 superfamily)
    duplication: two beta(4)-alpha structural repeats, related by pseudo twofold symmetry; two extra helices in the linker region; single 8-standed antiparallel beta-sheet, order: 12348765
  4. 882749Superfamily d.342.1: PH1570-like [159902] (1 family) (S)
  5. 882750Family d.342.1.1: PH1570-like [159903] (1 protein)
    Pfam PF09638
  6. 882751Protein Hypothetical protein PH1570 [159904] (1 species)
  7. 882752Species Pyrococcus horikoshii [TaxId:53953] [159905] (1 PDB entry)
    Uniprot O59278 1-152
  8. 882753Domain d2hq4a1: 2hq4 A:1-152 [147327]

Details for d2hq4a1

PDB Entry: 2hq4 (more details), 1.99 Å

PDB Description: crystal structure of orf 1580 a hypothetical protein from pyrococcus horikoshii
PDB Compounds: (A:) Hypothetical protein PH1570

SCOP Domain Sequences for d2hq4a1:

Sequence, based on SEQRES records: (download)

>d2hq4a1 d.342.1.1 (A:1-152) Hypothetical protein PH1570 {Pyrococcus horikoshii [TaxId: 53953]}
mqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyvypfecakef
wniylegeeiqdeefqlkpikftseqvikklqeeikkikppleikieeakiyktkegyla
vgnyfildprgrlfifnkpsiankilkyiwkw

Sequence, based on observed residues (ATOM records): (download)

>d2hq4a1 d.342.1.1 (A:1-152) Hypothetical protein PH1570 {Pyrococcus horikoshii [TaxId: 53953]}
mqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyvypfecakef
wniylegeeiqdqlkpikftseqvikklqeeikkikppleikieeakiyktkegylavgn
yfildprgrlfifnkpsiankilkyiwkw

SCOP Domain Coordinates for d2hq4a1:

Click to download the PDB-style file with coordinates for d2hq4a1.
(The format of our PDB-style files is described here.)

Timeline for d2hq4a1: