PDB entry 2hq4

View 2hq4 on RCSB PDB site
Description: Crystal Structure of ORF 1580 a hypothetical protein from Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: Singleton Protein, PH1580, STRUCTURAL GENOMICS, PSI SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, Protein Structure Initiative, UNKNOWN FUNCTION
Deposited on 2006-07-18, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PH1570
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59278 (9-160)
      • cloning artifact (0-8)
    Domains in SCOPe 2.08: d2hq4a1, d2hq4a2
  • Chain 'B':
    Compound: Hypothetical protein PH1570
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59278 (9-160)
      • cloning artifact (0-8)
    Domains in SCOPe 2.08: d2hq4b2, d2hq4b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hq4A (A:)
    dlyfqggsgmqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyv
    ypfecakefwniylegeeiqdeefqlkpikftseqvikklqeeikkikppleikieeaki
    yktkegylavgnyfildprgrlfifnkpsiankilkyiwkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq4A (A:)
    dlyfqggsgmqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyv
    ypfecakefwniylegeeiqdqlkpikftseqvikklqeeikkikppleikieeakiykt
    kegylavgnyfildprgrlfifnkpsiankilkyiwkw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hq4B (B:)
    dlyfqggsgmqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyv
    ypfecakefwniylegeeiqdeefqlkpikftseqvikklqeeikkikppleikieeaki
    yktkegylavgnyfildprgrlfifnkpsiankilkyiwkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq4B (B:)
    dlyfqggsgmqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyv
    ypfecakefwniylegeeiqdfqlkpikftseqvikklqeeikkikppleikieeakiyk
    tkegylavgnyfildprgrlfifnkpsiankilkyiwkw