Lineage for d2hoib1 (2hoi B:20-129)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494115Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. Family a.60.9.0: automated matches [254237] (1 protein)
    not a true family
  6. Protein automated matches [254539] (1 species)
    not a true protein
  7. Species Enterobacteria phage [TaxId:10678] [255219] (1 PDB entry)
  8. 1494188Domain d2hoib1: 2hoi B:20-129 [147319]
    Other proteins in same PDB: d2hoia2, d2hoib2, d2hoig2, d2hoih2
    automated match to d1drga1
    protein/DNA complex

Details for d2hoib1

PDB Entry: 2hoi (more details), 2.6 Å

PDB Description: crystal structure of the tetrameric pre-cleavage synaptic complex in the cre-loxp site-specific recombination
PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d2hoib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hoib1 a.60.9.0 (B:20-129) automated matches {Enterobacteria phage [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d2hoib1:

Click to download the PDB-style file with coordinates for d2hoib1.
(The format of our PDB-style files is described here.)

Timeline for d2hoib1: