SCOPe 2.08: Domain d2hoib1: 2hoi B:20-129

Lineage for d2hoib1 (2hoi B:20-129)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.60: SAM domain-like [47768] (17 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families)
Family a.60.9.0: automated matches [254237] (1 protein)
not a true family
Protein automated matches [254539] (1 species)
not a true protein
Species Enterobacteria phage [TaxId:10678] [255219] (1 PDB entry)
Domain d2hoib1: 2hoi B:20-129 [147319]
Other proteins in same PDB: d2hoia2, d2hoib2, d2hoig2, d2hoih2
automated match to d1drga1
protein/DNA complex

Details for d2hoib1

PDB Entry: 2hoi (more details), 2.6 Å

PDB Description: crystal structure of the tetrameric pre-cleavage synaptic complex in the cre-loxp site-specific recombination

PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d2hoib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hoib1 a.60.9.0 (B:20-129) automated matches {Enterobacteria phage [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d2hoib1:

Click to download the PDB-style file with coordinates for d2hoib1.
(The format of our PDB-style files is described here.)

Timeline for d2hoib1: