SCOPe 2.01: Domain d2hlya1: 2hly A:5-206

Lineage for d2hlya1 (2hly A:5-206)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.19: Atu2299-like [159849] (1 protein)
   Pfam PF09641; DUF2026; putative Cys/Ser-His-Asp catalytic triad

6. Protein Hypothetical protein Atu2299 [159850] (1 species)
   Serine catalytic nucleophile

7. Species Agrobacterium tumefaciens [TaxId:358] [159851] (1 PDB entry)
   Uniprot Q8UD29 1-202

8. Domain d2hlya1: 2hly A:5-206 [147310]

Details for d2hlya1

PDB Entry: 2hly, 1.6 Å

PDB Description: The crystal structure of genomics APC5867

PDB Compounds: (A:) Hypothetical protein Atu2299

SCOPe Domain Sequences for d2hlya1:

Sequence, based on SEQRES records:

>d2hlya1 d.3.1.19 (A:5-206) Hypothetical protein Atu2299 {Agrobacterium tumefaciens [TaxId: 358]}
mlikqtdyfriyrvinsllisqnadpasasmyfstfgafilqqhykvkavpkgglaaynl
ggtvllfadhredgyvtgagenfhcwveadgwaidfmapafsegtdalavpakmfqrpls
amaasindlgqsgdffyrsepeatarrfadwhkqamigdmasvaanwfrkspkqmaasls
vtdrdgkartvpltgemltgaw

Sequence, based on observed residues (ATOM records):

>d2hlya1 d.3.1.19 (A:5-206) Hypothetical protein Atu2299 {Agrobacterium tumefaciens [TaxId: 358]}
mlikqtdyfriyrvinsllisqnadpasasmyfstfgafilqqhykvkavpkgglaaynl
ggtvllfadhreyvtgagenfhcwveadgwaidfmapafsegtdalavpakmfqrplsam
aasindlgqsgdffyrsepeatarrfadwhkqamigdmasvaanwfrkspkqmaaslsvt
drdgkartvpltgemltgaw

Timeline for d2hlya1:

• d2hlya1 first appeared in SCOP 1.75
  
• d2hlya1 appears in SCOPe 2.02
  
• d2hlya1 appears in the current release, SCOPe 2.08