Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.19: Atu2299-like [159849] (1 protein) Pfam PF09641; DUF2026; putative Cys/Ser-His-Asp catalytic triad |
Protein Hypothetical protein Atu2299 [159850] (1 species) Serine catalytic nucleophile |
Species Agrobacterium tumefaciens [TaxId:358] [159851] (1 PDB entry) Uniprot Q8UD29 1-202 |
Domain d2hlya1: 2hly A:5-206 [147310] |
PDB Entry: 2hly (more details), 1.6 Å
SCOPe Domain Sequences for d2hlya1:
Sequence, based on SEQRES records: (download)
>d2hlya1 d.3.1.19 (A:5-206) Hypothetical protein Atu2299 {Agrobacterium tumefaciens [TaxId: 358]} mlikqtdyfriyrvinsllisqnadpasasmyfstfgafilqqhykvkavpkgglaaynl ggtvllfadhredgyvtgagenfhcwveadgwaidfmapafsegtdalavpakmfqrpls amaasindlgqsgdffyrsepeatarrfadwhkqamigdmasvaanwfrkspkqmaasls vtdrdgkartvpltgemltgaw
>d2hlya1 d.3.1.19 (A:5-206) Hypothetical protein Atu2299 {Agrobacterium tumefaciens [TaxId: 358]} mlikqtdyfriyrvinsllisqnadpasasmyfstfgafilqqhykvkavpkgglaaynl ggtvllfadhreyvtgagenfhcwveadgwaidfmapafsegtdalavpakmfqrplsam aasindlgqsgdffyrsepeatarrfadwhkqamigdmasvaanwfrkspkqmaaslsvt drdgkartvpltgemltgaw
Timeline for d2hlya1: