Lineage for d2hlya1 (2hly A:5-206)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927514Family d.3.1.19: Atu2299-like [159849] (1 protein)
    Pfam PF09641; DUF2026; putative Cys/Ser-His-Asp catalytic triad
  6. 2927515Protein Hypothetical protein Atu2299 [159850] (1 species)
    Serine catalytic nucleophile
  7. 2927516Species Agrobacterium tumefaciens [TaxId:358] [159851] (1 PDB entry)
    Uniprot Q8UD29 1-202
  8. 2927517Domain d2hlya1: 2hly A:5-206 [147310]
    Other proteins in same PDB: d2hlya2

Details for d2hlya1

PDB Entry: 2hly (more details), 1.6 Å

PDB Description: The crystal structure of genomics APC5867
PDB Compounds: (A:) Hypothetical protein Atu2299

SCOPe Domain Sequences for d2hlya1:

Sequence, based on SEQRES records: (download)

>d2hlya1 d.3.1.19 (A:5-206) Hypothetical protein Atu2299 {Agrobacterium tumefaciens [TaxId: 358]}
mlikqtdyfriyrvinsllisqnadpasasmyfstfgafilqqhykvkavpkgglaaynl
ggtvllfadhredgyvtgagenfhcwveadgwaidfmapafsegtdalavpakmfqrpls
amaasindlgqsgdffyrsepeatarrfadwhkqamigdmasvaanwfrkspkqmaasls
vtdrdgkartvpltgemltgaw

Sequence, based on observed residues (ATOM records): (download)

>d2hlya1 d.3.1.19 (A:5-206) Hypothetical protein Atu2299 {Agrobacterium tumefaciens [TaxId: 358]}
mlikqtdyfriyrvinsllisqnadpasasmyfstfgafilqqhykvkavpkgglaaynl
ggtvllfadhreyvtgagenfhcwveadgwaidfmapafsegtdalavpakmfqrplsam
aasindlgqsgdffyrsepeatarrfadwhkqamigdmasvaanwfrkspkqmaaslsvt
drdgkartvpltgemltgaw

SCOPe Domain Coordinates for d2hlya1:

Click to download the PDB-style file with coordinates for d2hlya1.
(The format of our PDB-style files is described here.)

Timeline for d2hlya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hlya2