Lineage for d2gyta1 (2gyt A:1-76)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493526Family a.60.1.3: Variant SAM domain [158526] (2 proteins)
    shares a sequence motif with Pfam PF07647, but has a distinct packing of helices
  6. 1493527Protein Deleted in liver cancer 1 protein, DLC-1 [158529] (1 species)
  7. 1493528Species Human (Homo sapiens) [TaxId:9606] [158530] (2 PDB entries)
    Uniprot Q96QB1 1-76! Uniprot Q96QB1 1-78
  8. 1493529Domain d2gyta1: 2gyt A:1-76 [147195]

Details for d2gyta1

PDB Entry: 2gyt (more details)

PDB Description: solution structure of the sam (sterile alpha motif) domain of dlc1 (deleted in liver cancer 1)
PDB Compounds: (A:) Deleted in liver cancer 1 protein, isoform 2

SCOPe Domain Sequences for d2gyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyta1 a.60.1.3 (A:1-76) Deleted in liver cancer 1 protein, DLC-1 {Human (Homo sapiens) [TaxId: 9606]}
mcrkkpdtmiltqieakeacdwlratgfpqyaqlyedflfpidislvkrehdfldrdaie
alcrrlntlnkcavmk

SCOPe Domain Coordinates for d2gyta1:

Click to download the PDB-style file with coordinates for d2gyta1.
(The format of our PDB-style files is described here.)

Timeline for d2gyta1: