| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.3: Variant SAM domain [158526] (2 proteins) shares a sequence motif with Pfam PF07647, but has a distinct packing of helices |
| Protein Deleted in liver cancer 1 protein, DLC-1 [158529] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [158530] (2 PDB entries) Uniprot Q96QB1 1-76! Uniprot Q96QB1 1-78 |
| Domain d2gyta1: 2gyt A:1-76 [147195] |
PDB Entry: 2gyt (more details)
SCOPe Domain Sequences for d2gyta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gyta1 a.60.1.3 (A:1-76) Deleted in liver cancer 1 protein, DLC-1 {Human (Homo sapiens) [TaxId: 9606]}
mcrkkpdtmiltqieakeacdwlratgfpqyaqlyedflfpidislvkrehdfldrdaie
alcrrlntlnkcavmk
Timeline for d2gyta1: