| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.17: Efb C-domain-like [158366] (1 family) ![]() automatically mapped to Pfam PF12199 |
| Family a.7.17.1: Efb C-domain-like [158367] (2 proteins) PfamB PB008033 this is a repeat family; one repeat unit is 2gom A:105-165 found in domain |
| Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries) Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165 |
| Domain d2goxb1: 2gox B:101-165 [147151] Other proteins in same PDB: d2goxa1, d2goxa2, d2goxc1, d2goxc2 |
PDB Entry: 2gox (more details), 2.2 Å
SCOPe Domain Sequences for d2goxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2goxb1 a.7.17.1 (B:101-165) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
tdatikkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlk
qglvr
Timeline for d2goxb1: