Lineage for d2goxd_ (2gox D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696944Superfamily a.7.17: Efb C-domain-like [158366] (1 family) (S)
    automatically mapped to Pfam PF12199
  5. 2696945Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
    PfamB PB008033
    this is a repeat family; one repeat unit is 2gom A:105-165 found in domain
  6. 2696946Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)
  7. 2696947Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
    Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165
  8. 2696953Domain d2goxd_: 2gox D: [147152]
    Other proteins in same PDB: d2goxa1, d2goxa2, d2goxc1, d2goxc2
    automated match to d2goxb1

Details for d2goxd_

PDB Entry: 2gox (more details), 2.2 Å

PDB Description: crystal structure of efb-c / c3d complex
PDB Compounds: (D:) Fibrinogen-binding protein

SCOPe Domain Sequences for d2goxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goxd_ a.7.17.1 (D:) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
tdatikkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlk
qglvr

SCOPe Domain Coordinates for d2goxd_:

Click to download the PDB-style file with coordinates for d2goxd_.
(The format of our PDB-style files is described here.)

Timeline for d2goxd_: