SCOPe 2.08: Domain d2goxd_: 2gox D:

Lineage for d2goxd_ (2gox D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.17: Efb C-domain-like [158366] (1 family)
   automatically mapped to Pfam PF12199

5. Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
   PfamB PB008033
   this is a repeat family; one repeat unit is 2gom A:105-165 found in domain

6. Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
   Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165

8. Domain d2goxd_: 2gox D: [147152]
   Other proteins in same PDB: d2goxa1, d2goxa2, d2goxc1, d2goxc2
   automated match to d2goxb1

Details for d2goxd_

PDB Entry: 2gox, 2.2 Å

PDB Description: crystal structure of efb-c / c3d complex

PDB Compounds: (D:) Fibrinogen-binding protein

SCOPe Domain Sequences for d2goxd_:

Sequence; same for both SEQRES and ATOM records:

>d2goxd_ a.7.17.1 (D:) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
tdatikkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlk
qglvr

Timeline for d2goxd_:

• d2goxd_ first appeared in SCOP 1.75, called d2goxd1
  
• d2goxd_ appears in SCOPe 2.07