SCOPe 2.08: Domain d2gbya2: 2gby A:73-187

Lineage for d2gbya2 (2gby A:73-187)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
   Uniprot P23217

8. Domain d2gbya2: 2gby A:73-187 [147103]
   Other proteins in same PDB: d2gbya1, d2gbyb1, d2gbyd1, d2gbye1
   automated match to d1rkwa2
   complexed with brn, so4

Details for d2gbya2

PDB Entry: 2gby, 2.9 Å

PDB Description: structure of qacr multidrug transcriptional regulator bound to bivalent diamidine berenil

PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2gbya2:

Sequence; same for both SEQRES and ATOM records:

>d2gbya2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d2gbya2:

• d2gbya2 first appeared in SCOP 1.75
  
• d2gbya2 appears in SCOPe 2.07