SCOPe 2.08: Domain d2gbye1: 2gby E:2-72

Lineage for d2gbye1 (2gby E:2-72)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
Protein Multidrug binding protein QacR [68964] (1 species)
Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
Uniprot P23217
Domain d2gbye1: 2gby E:2-72 [147108]
Other proteins in same PDB: d2gbya2, d2gbyb2, d2gbyd2, d2gbye2
automated match to d1rkwa1
complexed with brn, so4

Details for d2gbye1

PDB Entry: 2gby (more details), 2.9 Å

PDB Description: structure of qacr multidrug transcriptional regulator bound to bivalent diamidine berenil

PDB Compounds: (E:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2gbye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbye1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d2gbye1:

Click to download the PDB-style file with coordinates for d2gbye1.
(The format of our PDB-style files is described here.)

Timeline for d2gbye1: