SCOP 1.75: Domain d2g3fb2: 2g3f B:74-373

Lineage for d2g3fb2 (2g3f B:74-373)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)

6. Protein Imidazolonepropionase [159405] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [159406] (2 PDB entries)
   Uniprot P42084 74-373

8. Domain d2g3fb2: 2g3f B:74-373 [147076]
   Other proteins in same PDB: d2g3fa1, d2g3fb1
   automatically matched to 2BB0 A:74-373
   complexed with izc, zn

Details for d2g3fb2

PDB Entry: 2g3f, 2 Å

PDB Description: crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue

PDB Compounds: (B:) Imidazolonepropionase

SCOP Domain Sequences for d2g3fb2:

Sequence; same for both SEQRES and ATOM records:

>d2g3fb2 c.1.9.17 (B:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
pglvdphthlvfggsrekemnlklqgisyldilaqgggilstvkdtraaseeellqkahf
hlqrmlsygtttaevksgygleketelkqlrvakklhesqpvdlvstfmgahaippeyqn
dpddfldqmlsllpeikeqelasfadiftetgvftvsqsrrylqkaaeagfglkihadei
dplggaelagklkavsadhlvgtsdegikklaeagtiavllpgttfylgkstyararami
degvcvslatdfnpgsspteniqlimsiaalhlkmtaeeiwhavtvnaayaigkgeeagq

Timeline for d2g3fb2:

• d2g3fb2 is new in SCOP 1.75
  
• d2g3fb2 appears in SCOPe 2.01
  
• d2g3fb2 appears in the current release, SCOPe 2.08