![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins) |
![]() | Protein Imidazolonepropionase [159405] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159406] (2 PDB entries) Uniprot P42084 74-373 |
![]() | Domain d2g3fa2: 2g3f A:74-373 [147074] Other proteins in same PDB: d2g3fa1, d2g3fb1 automatically matched to 2BB0 A:74-373 complexed with izc, zn |
PDB Entry: 2g3f (more details), 2 Å
SCOP Domain Sequences for d2g3fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3fa2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} pglvdphthlvfggsrekemnlklqgisyldilaqgggilstvkdtraaseeellqkahf hlqrmlsygtttaevksgygleketelkqlrvakklhesqpvdlvstfmgahaippeyqn dpddfldqmlsllpeikeqelasfadiftetgvftvsqsrrylqkaaeagfglkihadei dplggaelagklkavsadhlvgtsdegikklaeagtiavllpgttfylgkstyararami degvcvslatdfnpgsspteniqlimsiaalhlkmtaeeiwhavtvnaayaigkgeeagq
Timeline for d2g3fa2: