SCOPe 2.01: Domain d2g3fb1: 2g3f B:3-73,B:374-415

Lineage for d2g3fb1 (2g3f B:3-73,B:374-415)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)

6. Protein Imidazolonepropionase [159348] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [159349] (2 PDB entries)
   Uniprot P42084 3-73,374-415

8. Domain d2g3fb1: 2g3f B:3-73,B:374-415 [147075]
   Other proteins in same PDB: d2g3fa2, d2g3fb2
   automatically matched to 2BB0 A:3-73,A:374-415
   complexed with izc, zn

Details for d2g3fb1

PDB Entry: 2g3f, 2 Å

PDB Description: crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue

PDB Compounds: (B:) Imidazolonepropionase

SCOPe Domain Sequences for d2g3fb1:

Sequence; same for both SEQRES and ATOM records:

>d2g3fb1 b.92.1.10 (B:3-73,B:374-415) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
kqidtilinigqlltmessgpragksmqdlhviedavvgiheqkivfagqkgaeagyead
eiidcsgrlvtXlkagrsadlviwqapnymyipyhygvnhvhqvmkngtivvnr

Timeline for d2g3fb1:

• d2g3fb1 first appeared in SCOP 1.75
  
• d2g3fb1 appears in SCOPe 2.02
  
• d2g3fb1 appears in the current release, SCOPe 2.08