Lineage for d2g3fa2 (2g3f A:74-373)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 972077Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)
  6. 972078Protein Imidazolonepropionase [159405] (2 species)
  7. 972084Species Bacillus subtilis [TaxId:1423] [159406] (2 PDB entries)
    Uniprot P42084 74-373
  8. 972085Domain d2g3fa2: 2g3f A:74-373 [147074]
    Other proteins in same PDB: d2g3fa1, d2g3fb1
    automatically matched to 2BB0 A:74-373
    complexed with izc, zn

Details for d2g3fa2

PDB Entry: 2g3f (more details), 2 Å

PDB Description: crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue
PDB Compounds: (A:) Imidazolonepropionase

SCOPe Domain Sequences for d2g3fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3fa2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
pglvdphthlvfggsrekemnlklqgisyldilaqgggilstvkdtraaseeellqkahf
hlqrmlsygtttaevksgygleketelkqlrvakklhesqpvdlvstfmgahaippeyqn
dpddfldqmlsllpeikeqelasfadiftetgvftvsqsrrylqkaaeagfglkihadei
dplggaelagklkavsadhlvgtsdegikklaeagtiavllpgttfylgkstyararami
degvcvslatdfnpgsspteniqlimsiaalhlkmtaeeiwhavtvnaayaigkgeeagq

SCOPe Domain Coordinates for d2g3fa2:

Click to download the PDB-style file with coordinates for d2g3fa2.
(The format of our PDB-style files is described here.)

Timeline for d2g3fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g3fa1