SCOPe 2.08: Domain d2g0jc2: 2g0j C:1-111

Lineage for d2g0jc2 (2g0j C:1-111)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.64: eIF1-like [55158] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243

4. Superfamily d.64.2: TM1457-like [118010] (1 family)
   forms a homodimer via alpha-helical interface
   automatically mapped to Pfam PF04327

5. Family d.64.2.1: TM1457-like [118011] (5 proteins)
   Pfam PF04327; DUF464

6. Protein Hypothetical protein Smu.848 [160434] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [160435] (2 PDB entries)
   Uniprot Q8DUQ5 1-111

8. Domain d2g0jc2: 2g0j C:1-111 [147070]
   Other proteins in same PDB: d2g0ja3, d2g0jb3, d2g0jc3, d2g0jd3
   automated match to d2g0ia1

Details for d2g0jc2

PDB Entry: 2g0j, 2.8 Å

PDB Description: crystal structure of smu.848 from streptococcus mutans

PDB Compounds: (C:) hypothetical protein SMU.848

SCOPe Domain Sequences for d2g0jc2:

Sequence; same for both SEQRES and ATOM records:

>d2g0jc2 d.64.2.1 (C:1-111) Hypothetical protein Smu.848 {Streptococcus mutans [TaxId: 1309]}
miqatfirrkgilesveltghagsgeygfdivcaavstlsmnlvnalevladctvslqmd
efdggymkidlsyitnksdekvqllfeafllgitnlaenspefvtakimtq

Timeline for d2g0jc2:

• d2g0jc2 first appeared in SCOP 1.75, called d2g0jc1
  
• d2g0jc2 appears in SCOPe 2.07