Lineage for d2g0jd2 (2g0j D:1-111)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956745Fold d.64: eIF1-like [55158] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243
  4. 2956754Superfamily d.64.2: TM1457-like [118010] (1 family) (S)
    forms a homodimer via alpha-helical interface
    automatically mapped to Pfam PF04327
  5. 2956755Family d.64.2.1: TM1457-like [118011] (5 proteins)
    Pfam PF04327; DUF464
  6. 2956760Protein Hypothetical protein Smu.848 [160434] (1 species)
  7. 2956761Species Streptococcus mutans [TaxId:1309] [160435] (2 PDB entries)
    Uniprot Q8DUQ5 1-111
  8. 2956767Domain d2g0jd2: 2g0j D:1-111 [147071]
    Other proteins in same PDB: d2g0ja3, d2g0jb3, d2g0jc3, d2g0jd3
    automated match to d2g0ia1

Details for d2g0jd2

PDB Entry: 2g0j (more details), 2.8 Å

PDB Description: crystal structure of smu.848 from streptococcus mutans
PDB Compounds: (D:) hypothetical protein SMU.848

SCOPe Domain Sequences for d2g0jd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0jd2 d.64.2.1 (D:1-111) Hypothetical protein Smu.848 {Streptococcus mutans [TaxId: 1309]}
miqatfirrkgilesveltghagsgeygfdivcaavstlsmnlvnalevladctvslqmd
efdggymkidlsyitnksdekvqllfeafllgitnlaenspefvtakimtq

SCOPe Domain Coordinates for d2g0jd2:

Click to download the PDB-style file with coordinates for d2g0jd2.
(The format of our PDB-style files is described here.)

Timeline for d2g0jd2: