![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.64: eIF1-like [55158] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243 |
![]() | Superfamily d.64.2: TM1457-like [118010] (1 family) ![]() forms a homodimer via alpha-helical interface automatically mapped to Pfam PF04327 |
![]() | Family d.64.2.1: TM1457-like [118011] (5 proteins) Pfam PF04327; DUF464 |
![]() | Protein Hypothetical protein Smu.848 [160434] (1 species) |
![]() | Species Streptococcus mutans [TaxId:1309] [160435] (2 PDB entries) Uniprot Q8DUQ5 1-111 |
![]() | Domain d2g0jd2: 2g0j D:1-111 [147071] Other proteins in same PDB: d2g0ja3, d2g0jb3, d2g0jc3, d2g0jd3 automated match to d2g0ia1 |
PDB Entry: 2g0j (more details), 2.8 Å
SCOPe Domain Sequences for d2g0jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g0jd2 d.64.2.1 (D:1-111) Hypothetical protein Smu.848 {Streptococcus mutans [TaxId: 1309]} miqatfirrkgilesveltghagsgeygfdivcaavstlsmnlvnalevladctvslqmd efdggymkidlsyitnksdekvqllfeafllgitnlaenspefvtakimtq
Timeline for d2g0jd2: