| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.64: eIF1-like [55158] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243 |
Superfamily d.64.2: TM1457-like [118010] (1 family) ![]() forms a homodimer via alpha-helical interface automatically mapped to Pfam PF04327 |
| Family d.64.2.1: TM1457-like [118011] (5 proteins) Pfam PF04327; DUF464 |
| Protein Hypothetical protein Smu.848 [160434] (1 species) |
| Species Streptococcus mutans [TaxId:1309] [160435] (2 PDB entries) Uniprot Q8DUQ5 1-111 |
| Domain d2g0ia1: 2g0i A:1-111 [147066] Other proteins in same PDB: d2g0ia2, d2g0ib3 complexed with ca, peg |
PDB Entry: 2g0i (more details), 1.85 Å
SCOPe Domain Sequences for d2g0ia1:
Sequence, based on SEQRES records: (download)
>d2g0ia1 d.64.2.1 (A:1-111) Hypothetical protein Smu.848 {Streptococcus mutans [TaxId: 1309]}
miqatfirrkgilesveltghagsgeygfdivcaavstlsmnlvnalevladctvslqmd
efdggymkidlsyitnksdekvqllfeafllgitnlaenspefvtakimtq
>d2g0ia1 d.64.2.1 (A:1-111) Hypothetical protein Smu.848 {Streptococcus mutans [TaxId: 1309]}
miqatfirrkgilesveltghasgeygfdivcaavstlsmnlvnalevladctvslqmde
fdggymkidlsyitnksdekvqllfeafllgitnlaenspefvtakimtq
Timeline for d2g0ia1: