Lineage for d2fhfa4 (2fhf A:966-1083)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960875Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 960876Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 960877Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 961245Protein Pullulanase PulA [159262] (1 species)
  7. 961246Species Klebsiella pneumoniae [TaxId:573] [159263] (3 PDB entries)
    Uniprot P07206 973-1090
  8. 961247Domain d2fhfa4: 2fhf A:966-1083 [147038]
    Other proteins in same PDB: d2fhfa1, d2fhfa2, d2fhfa3, d2fhfa5
    complexed with ca

Details for d2fhfa4

PDB Entry: 2fhf (more details), 1.65 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltotetraose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhfa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhfa4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

SCOPe Domain Coordinates for d2fhfa4:

Click to download the PDB-style file with coordinates for d2fhfa4.
(The format of our PDB-style files is described here.)

Timeline for d2fhfa4: