SCOPe 2.08: Domain d2fhfa4: 2fhf A:966-1083

Lineage for d2fhfa4 (2fhf A:966-1083)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Pullulanase PulA [159262] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries)
   Uniprot P07206 973-1090

8. Domain d2fhfa4: 2fhf A:966-1083 [147038]
   Other proteins in same PDB: d2fhfa1, d2fhfa2, d2fhfa3, d2fhfa5
   complexed with ca
   has additional insertions and/or extensions that are not grouped together

Details for d2fhfa4

PDB Entry: 2fhf, 1.65 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltotetraose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhfa4:

Sequence; same for both SEQRES and ATOM records:

>d2fhfa4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

Timeline for d2fhfa4:

• d2fhfa4 first appeared in SCOP 1.75
  
• d2fhfa4 appears in SCOPe 2.07