SCOPe 2.02: Domain d2f86b1: 2f86 B:343-471

Lineage for d2f86b1 (2f86 B:343-471)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)

6. Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [159961] (1 PDB entry)
   Uniprot Q9U6Q0 343-471

8. Domain d2f86b1: 2f86 B:343-471 [146998]
   Other proteins in same PDB: d2f86d_, d2f86f_, d2f86h_, d2f86j_, d2f86l_, d2f86n_

Details for d2f86b1

PDB Entry: 2f86, 2.64 Å

PDB Description: the association domain of c. elegans camkii

PDB Compounds: (B:) Hypothetical protein K11E8.1d

SCOPe Domain Sequences for d2f86b1:

Sequence; same for both SEQRES and ATOM records:

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf
dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw
vcvhvhrst

Timeline for d2f86b1:

• d2f86b1 first appeared in SCOP 1.75
  
• d2f86b1 appears in SCOPe 2.01
  
• d2f86b1 appears in SCOPe 2.03
  
• d2f86b1 appears in the current release, SCOPe 2.08