| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins) |
| Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species) |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [159961] (1 PDB entry) Uniprot Q9U6Q0 343-471 |
| Domain d2f86b1: 2f86 B:343-471 [146998] Other proteins in same PDB: d2f86d_, d2f86f_, d2f86h_, d2f86j_, d2f86l_, d2f86n_ |
PDB Entry: 2f86 (more details), 2.64 Å
SCOPe Domain Sequences for d2f86b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf
dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw
vcvhvhrst
Timeline for d2f86b1: