Lineage for d2f86b1 (2f86 B:343-471)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020392Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
  6. 1020393Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species)
  7. 1020411Species Nematode (Caenorhabditis elegans) [TaxId:6239] [159961] (1 PDB entry)
    Uniprot Q9U6Q0 343-471
  8. 1020412Domain d2f86b1: 2f86 B:343-471 [146998]
    Other proteins in same PDB: d2f86d_, d2f86f_, d2f86h_, d2f86j_, d2f86l_, d2f86n_

Details for d2f86b1

PDB Entry: 2f86 (more details), 2.64 Å

PDB Description: the association domain of c. elegans camkii
PDB Compounds: (B:) Hypothetical protein K11E8.1d

SCOPe Domain Sequences for d2f86b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf
dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw
vcvhvhrst

SCOPe Domain Coordinates for d2f86b1:

Click to download the PDB-style file with coordinates for d2f86b1.
(The format of our PDB-style files is described here.)

Timeline for d2f86b1: