Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (4 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein Type II pantothenate kinase, CoaW [159626] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [159627] (2 PDB entries) Uniprot Q8NVG0 1-267 |
Domain d2ewsb2: 2ews B:2-266 [146992] Other proteins in same PDB: d2ewsa2, d2ewsb3 automated match to d2ewsa1 complexed with anp, mg |
PDB Entry: 2ews (more details), 2.05 Å
SCOPe Domain Sequences for d2ewsb2:
Sequence, based on SEQRES records: (download)
>d2ewsb2 c.55.1.14 (B:2-266) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} kvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaeni nipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgg gmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlh hldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedyt vlrgckpyyvengafsgaigalyle
>d2ewsb2 c.55.1.14 (B:2-266) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} kvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaeni nipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgg gmiqglgyllsqitdykqltdmaqhgdrntidlkvrhipgdltaanfghvlhhldadftp snklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytvlrgckpy yvengafsgaigalyle
Timeline for d2ewsb2: