Lineage for d2ewsb2 (2ews B:2-266)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2123116Family c.55.1.14: Fumble-like [159623] (4 protein domains)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2123147Protein Type II pantothenate kinase, CoaW [159626] (1 species)
  7. 2123148Species Staphylococcus aureus [TaxId:1280] [159627] (2 PDB entries)
    Uniprot Q8NVG0 1-267
  8. 2123150Domain d2ewsb2: 2ews B:2-266 [146992]
    Other proteins in same PDB: d2ewsa2, d2ewsb3
    automated match to d2ewsa1
    complexed with anp, mg

Details for d2ewsb2

PDB Entry: 2ews (more details), 2.05 Å

PDB Description: Crystal structure of S.aureus pantothenate kinase
PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d2ewsb2:

Sequence, based on SEQRES records: (download)

>d2ewsb2 c.55.1.14 (B:2-266) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]}
kvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaeni
nipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgg
gmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlh
hldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedyt
vlrgckpyyvengafsgaigalyle

Sequence, based on observed residues (ATOM records): (download)

>d2ewsb2 c.55.1.14 (B:2-266) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]}
kvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaeni
nipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgg
gmiqglgyllsqitdykqltdmaqhgdrntidlkvrhipgdltaanfghvlhhldadftp
snklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytvlrgckpy
yvengafsgaigalyle

SCOPe Domain Coordinates for d2ewsb2:

Click to download the PDB-style file with coordinates for d2ewsb2.
(The format of our PDB-style files is described here.)

Timeline for d2ewsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ewsb3