| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
| Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
| Protein Radixin [47035] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries) |
| Domain d2emsa1: 2ems A:88-198 [146925] Other proteins in same PDB: d2emsa2, d2emsa3, d2emsa4 automatically matched to d1gc6a1 |
PDB Entry: 2ems (more details), 2.9 Å
SCOPe Domain Sequences for d2emsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2emsa1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl
Timeline for d2emsa1: