Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243) |
Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
Domain d2ehoc2: 2eho C:1-61 [146847] Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog1, d2ehog2, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok1, d2ehok2, d2ehok3, d2ehol1, d2ehol2 complexed with so4 |
PDB Entry: 2eho (more details), 3 Å
SCOPe Domain Sequences for d2ehoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehoc2 d.344.1.2 (C:1-61) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]} mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl l
Timeline for d2ehoc2: