![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein automated matches [190054] (15 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187272] (5 PDB entries) |
![]() | Domain d2efyb_: 2efy B: [146825] automated match to d1ve1a1 complexed with 4at, plp |
PDB Entry: 2efy (more details), 2.35 Å
SCOPe Domain Sequences for d2efyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efyb_ c.79.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl ya
Timeline for d2efyb_: