Lineage for d2efyb_ (2efy B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) Protein automated matches [190054] (13 species)
not a true protein
Species Thermus thermophilus HB8 [TaxId:300852] [187272] (5 PDB entries) 
Domain d2efyb_: 2efy B: [146825]
automated match to d1ve1a1
complexed with 4at, plp
Details for d2efyb_
PDB Entry: 2efy (more details), 2.35 Å
PDB Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 4-Acetylbutyric acid
PDB Compounds: (B:) O-acetylserine (Thiol)-lyaseSCOPe Domain Sequences for d2efyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efyb_ c.79.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
ya
SCOPe Domain Coordinates for d2efyb_:
Click to download the PDB-style file with coordinates for d2efyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2efyb_:
- d2efyb_ first appeared in SCOP 1.75, called d2efyb1
- d2efyb_ appears in SCOPe 2.07
View in 3D
