Lineage for d2e88a2 (2e88 A:189-383)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605420Protein automated matches [226905] (11 species)
    not a true protein
  7. 1605468Species Human (Homo sapiens) [TaxId:9606] [225574] (14 PDB entries)
  8. 1605480Domain d2e88a2: 2e88 A:189-383 [146715]
    automated match to d2e8aa2
    complexed with zn

Details for d2e88a2

PDB Entry: 2e88 (more details), 1.8 Å

PDB Description: Crystal structure of the human Hsp70 ATPase domain in the apo form
PDB Compounds: (A:) Heat shock 70kDa protein 1A

SCOPe Domain Sequences for d2e88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e88a2 c.55.1.1 (A:189-383) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaailmgd

SCOPe Domain Coordinates for d2e88a2:

Click to download the PDB-style file with coordinates for d2e88a2.
(The format of our PDB-style files is described here.)

Timeline for d2e88a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e88a1