Lineage for d2dsyb_ (2dsy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010430Fold d.304: TTHA1013/TTHA0281-like [143099] (1 superfamily)
    beta(3)-alpha-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other; topological similarity to the SEP domain fold (102847); dimerises via the long C-terminal strand with the formation of a single beta-sheet
  4. 3010431Superfamily d.304.1: TTHA1013/TTHA0281-like [143100] (2 families) (S)
  5. 3010436Family d.304.1.2: TTHA0281-like [160109] (2 proteins)
    Pfam PF03681; UPF0150; alpha-beta(3)-alpha-X
  6. 3010440Protein automated matches [190611] (1 species)
    not a true protein
  7. 3010441Species Thermus thermophilus [TaxId:274] [187633] (1 PDB entry)
  8. 3010442Domain d2dsyb_: 2dsy B: [146570]
    Other proteins in same PDB: d2dsya1
    automated match to d2dsya1
    complexed with mg, nhe

Details for d2dsyb_

PDB Entry: 2dsy (more details), 1.9 Å

PDB Description: Crystal structure of TTHA0281 from thermus thermophilus HB8
PDB Compounds: (B:) Hypothetical protein TTHA0281

SCOPe Domain Sequences for d2dsyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsyb_ d.304.1.2 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
mgtltryleeamararyeliadeepyygeipdlpgvwatgkslkeceanlqaaledwllf
llsrgetppplgevrie

SCOPe Domain Coordinates for d2dsyb_:

Click to download the PDB-style file with coordinates for d2dsyb_.
(The format of our PDB-style files is described here.)

Timeline for d2dsyb_: