Lineage for d2dsya1 (2dsy A:3-82)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010430Fold d.304: TTHA1013/TTHA0281-like [143099] (1 superfamily)
    beta(3)-alpha-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other; topological similarity to the SEP domain fold (102847); dimerises via the long C-terminal strand with the formation of a single beta-sheet
  4. 3010431Superfamily d.304.1: TTHA1013/TTHA0281-like [143100] (2 families) (S)
  5. 3010436Family d.304.1.2: TTHA0281-like [160109] (2 proteins)
    Pfam PF03681; UPF0150; alpha-beta(3)-alpha-X
  6. 3010437Protein Hypothetical protein TTHA0281 [160110] (1 species)
  7. 3010438Species Thermus thermophilus [TaxId:274] [160111] (1 PDB entry)
    Uniprot Q5SLL2 3-82
  8. 3010439Domain d2dsya1: 2dsy A:3-82 [146569]
    Other proteins in same PDB: d2dsyb_, d2dsyc_, d2dsyd_
    complexed with mg, nhe

Details for d2dsya1

PDB Entry: 2dsy (more details), 1.9 Å

PDB Description: Crystal structure of TTHA0281 from thermus thermophilus HB8
PDB Compounds: (A:) Hypothetical protein TTHA0281

SCOPe Domain Sequences for d2dsya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsya1 d.304.1.2 (A:3-82) Hypothetical protein TTHA0281 {Thermus thermophilus [TaxId: 274]}
gmgtltryleeamararyeliadeepyygeipdlpgvwatgkslkeceanlqaaledwll
fllsrgetppplgevrielp

SCOPe Domain Coordinates for d2dsya1:

Click to download the PDB-style file with coordinates for d2dsya1.
(The format of our PDB-style files is described here.)

Timeline for d2dsya1: